Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUTF2 Rabbit pAb (APR20158N)

Product Specifications

Background

This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts with the nuclear pore complex glycoprotein p62.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NUTF2 Rabbit pAb (APR20158N) .

Synonyms

NUTF2; NTF-2; NTF2; PP15

Gene ID

10204

UniProt

P61970

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10204

Uniprot URL

https://www.uniprot.org/uniprot/P61970

AA Sequence

MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMD sgRNA CRISPR Lentivector set (Human)
K0609301 3x 1.0 µg

DMD sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
F9, ID (F9, Coagulation factor IX, Christmas factor, Plasma thromboplastin component, Coagulation factor IXa light chain, Coagulation factor IXa heavy chain) (MaxLight 405)
MBS6297421-01 0.1 mL

F9, ID (F9, Coagulation factor IX, Christmas factor, Plasma thromboplastin component, Coagulation factor IXa light chain, Coagulation factor IXa heavy chain) (MaxLight 405)

Sign In for Pricing
View Details
F9, ID (F9, Coagulation factor IX, Christmas factor, Plasma thromboplastin component, Coagulation factor IXa light chain, Coagulation factor IXa heavy chain) (MaxLight 405)
MBS6297421-02 5x 0.1 mL

F9, ID (F9, Coagulation factor IX, Christmas factor, Plasma thromboplastin component, Coagulation factor IXa light chain, Coagulation factor IXa heavy chain) (MaxLight 405)

Sign In for Pricing
View Details
MUC6 Antibody
MBS8518651-01 0.05 mg

MUC6 Antibody

Sign In for Pricing
View Details
MUC6 Antibody
MBS8518651-02 0.1 mg

MUC6 Antibody

Sign In for Pricing
View Details
MUC6 Antibody
MBS8518651-03 0.1 mL (AF750)

MUC6 Antibody

Sign In for Pricing
View Details