What is the catalog number for PP1 beta Rabbit pAb (APR20115N)?

The catalog number for PP1 beta Rabbit pAb (APR20115N) is APR20115N.

What sizes are available for PP1 beta Rabbit pAb (APR20115N)?

PP1 beta Rabbit pAb (APR20115N) is available in the following size(s): 50 µL, 100 µL, 200 µL.

How many pack sizes does PP1 beta Rabbit pAb (APR20115N) come in?

PP1 beta Rabbit pAb (APR20115N) is available in 3 different pack sizes.

Is PP1 beta Rabbit pAb (APR20115N) in stock?

PP1 beta Rabbit pAb (APR20115N) is currently made to order / not held in immediate stock. Contact us for lead time.

PP1 beta Rabbit pAb (APR20115N)

Product Specifications

Background

The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1) . PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PP1 beta Rabbit pAb (APR20115N) .

Synonyms

PPP1CB; HEL-S-80p; PP-1B; PP1B; PP1beta; PPP1CD; NSLH2

Gene ID

5500

UniProt

P62140

Cellular Locus

Cytoplasm, Nucleus, nucleolus, nucleoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5500

Uniprot URL

https://www.uniprot.org/uniprot/P62140

AA Sequence

MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR