Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PP1 beta Rabbit pAb (APR20115N)

Product Specifications

Background

The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1) . PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PP1 beta Rabbit pAb (APR20115N) .

Synonyms

PPP1CB; HEL-S-80p; PP-1B; PP1B; PP1beta; PPP1CD; NSLH2

Gene ID

5500

UniProt

P62140

Cellular Locus

Cytoplasm, Nucleus, nucleolus, nucleoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5500

Uniprot URL

https://www.uniprot.org/uniprot/P62140

AA Sequence

MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dihydropteridine reductase (QDPR) ELISA Kit
RK12959 96 Tests

Mouse Dihydropteridine reductase (QDPR) ELISA Kit

Sign In for Pricing
View Details
HIRAK1 (S376) (Interleukin-1 receptor-associated kinase 1, IRAK1, IRAK) (AP) discontinued
036573-AP 200 µL

HIRAK1 (S376) (Interleukin-1 receptor-associated kinase 1, IRAK1, IRAK) (AP) discontinued

Sign In for Pricing
View Details
Olfr1121 (NM_146348) Mouse Tagged ORF Clone Lentiviral Particle
MR215075L4V 200 µL

Olfr1121 (NM_146348) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Elof1 (NM_001126098) Rat Tagged Lenti ORF Clone
RR202764L3 10 µg

Elof1 (NM_001126098) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SUGT1, CT (SUGT1, Suppressor of G2 allele of SKP1 homolog, Protein 40-6-3, Sgt1) (APC) discontinued
042456-APC 200 µL

SUGT1, CT (SUGT1, Suppressor of G2 allele of SKP1 homolog, Protein 40-6-3, Sgt1) (APC) discontinued

Sign In for Pricing
View Details
Neisseria gonorrhoeae antibody
MBS531155-01 0.5 mg

Neisseria gonorrhoeae antibody

Sign In for Pricing
View Details