Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL1A1 Rabbit pAb (APR20108N)

Product Specifications

Background

This gene encodes the pro-alpha1 chains of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COL1A1 Rabbit pAb (APR20108N) .

Synonyms

COL1A1; EDSC; OI1; OI2; OI3; OI4

Gene ID

1277

UniProt

P02452

Cellular Locus

Secreted, extracellular matrix, extracellular space

Applications

IF (Homo sapiens, Mus musculus, Rattus norvegicus) . (Mus musculus) WB (Rattus norvegicus, Homo sapiens, Mus musculus) IHC (Mus musculus, Homo sapiens, Bovine)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 138kDa Observed MW: 140KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1277

Uniprot URL

https://www.uniprot.org/uniprot/P02452

AA Sequence

ESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF469 Human Gene Knockout Kit (CRISPR)
KN435404 1 Kit

ZNF469 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZFYVE19 Antibody
8C19582-AAT 50 µg

ZFYVE19 Antibody

Sign In for Pricing
View Details
Cars2 Mouse Gene Knockout Kit (CRISPR)
KN502552 1 Kit

Cars2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat PINP (Procollagen I N-Terminal Propeptide) ELISA Kit
E-EL-R1414-01 24 Tests

Rat PINP (Procollagen I N-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
Rat PINP (Procollagen I N-Terminal Propeptide) ELISA Kit
E-EL-R1414-02 48 Tests

Rat PINP (Procollagen I N-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
Rat PINP (Procollagen I N-Terminal Propeptide) ELISA Kit
E-EL-R1414-03 96 Tests

Rat PINP (Procollagen I N-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details