Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM5 Rabbit pAb (APR20103N)

Product Specifications

Background

The protein encoded by this gene is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MCM5 Rabbit pAb (APR20099N4) .

Synonyms

MCM5; CDC46; P1-CDC46

Gene ID

4174

UniProt

P33992

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 82kDa Observed MW: 100kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4174

Uniprot URL

https://www.uniprot.org/uniprot/P33992

AA Sequence

MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEVLQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLTNIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken USP8 (Ubiquitin Specific Peptidase 8) ELISA Kit
MBS2501010-01 24 Tests

Chicken USP8 (Ubiquitin Specific Peptidase 8) ELISA Kit

Sign In for Pricing
View Details
Chicken USP8 (Ubiquitin Specific Peptidase 8) ELISA Kit
MBS2501010-02 48 Tests

Chicken USP8 (Ubiquitin Specific Peptidase 8) ELISA Kit

Sign In for Pricing
View Details
Chicken USP8 (Ubiquitin Specific Peptidase 8) ELISA Kit
MBS2501010-03 96 Tests

Chicken USP8 (Ubiquitin Specific Peptidase 8) ELISA Kit

Sign In for Pricing
View Details
Chicken USP8 (Ubiquitin Specific Peptidase 8) ELISA Kit
MBS2501010-04 5x 96 Tests

Chicken USP8 (Ubiquitin Specific Peptidase 8) ELISA Kit

Sign In for Pricing
View Details
Chicken USP8 (Ubiquitin Specific Peptidase 8) ELISA Kit
MBS2501010-05 10x 96 Tests

Chicken USP8 (Ubiquitin Specific Peptidase 8) ELISA Kit

Sign In for Pricing
View Details
Rims3 ORF Vector (Rat) (pORF)
39597016 1.0 µg DNA

Rims3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details