Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIG3 Rabbit pAb (APR20096N)

Product Specifications

Background

This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LIG3 Rabbit pAb (APR20096N) .

Synonyms

LIG3; LIG2

Gene ID

3980

UniProt

P49916

Cellular Locus

Mitochondrion, Mitochondrion, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 95kDa/102kDa/106kDa/112kDa Observed MW: 105KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3980

Uniprot URL

https://www.uniprot.org/uniprot/P49916

AA Sequence

AGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTVVAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Keyhole Limpet Hemocyanin IgG (KLH IgG) ELISA Kit
abx392546 96 Tests

Mouse Keyhole Limpet Hemocyanin IgG (KLH IgG) ELISA Kit

Sign In for Pricing
View Details
Rat CPS1 siRNA
abx912699-01 15 nmol

Rat CPS1 siRNA

Sign In for Pricing
View Details
Rat CPS1 siRNA
abx912699-02 30 nmol

Rat CPS1 siRNA

Sign In for Pricing
View Details
IGF 1 Polyclonal Antibody Bio Conjugated
C90005Bio 100 µL

IGF 1 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
RFX2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1813604 1.0 µg DNA

RFX2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
JMY (G-11) AC
sc-166030 AC 500 µg/mL - 25% ag

JMY (G-11) AC

Sign In for Pricing
View Details