Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD127/IL7R Rabbit pAb (APR20092N)

Product Specifications

Background

The protein encoded by this gene is a receptor for interleukin 7 (IL7) . The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V (D) J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID) . Alternatively spliced transcript variants have been found.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD127/IL7R Rabbit pAb (APR20092N) .

Synonyms

IL7R; CD127; CDW127; IL-7R-alpha; IL7RA; ILRA

Gene ID

3575

UniProt

P16871

Cellular Locus

Cell membrane, Secreted, Single-pass type I membrane protein, Single-pass type I membrane protein

Dilution

IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 65-90kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3575

Uniprot URL

https://www.uniprot.org/uniprot/P16871

AA Sequence

ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diclofenac Ethyl Ester
TRC-D436495-250MG 250 mg

Diclofenac Ethyl Ester

Sign In for Pricing
View Details
GLI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C10]
TA803921BM 100 µL

GLI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C10]

Sign In for Pricing
View Details
4-Aminobenzoic Acid
TRC-A591500-5G 5 g

4-Aminobenzoic Acid

Sign In for Pricing
View Details
Sandospace R
TRC-S115305-500MG 500 mg

Sandospace R

Sign In for Pricing
View Details
Human Bruton'S Tyrosine Kinase (Btk) ELISA Kit
RD-Btk-Hu-01 96 Tests

Human Bruton'S Tyrosine Kinase (Btk) ELISA Kit

Sign In for Pricing
View Details
Human Bruton'S Tyrosine Kinase (Btk) ELISA Kit
RD-Btk-Hu-02 48 Tests

Human Bruton'S Tyrosine Kinase (Btk) ELISA Kit

Sign In for Pricing
View Details