Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJA5 Rabbit pAb (APR20083N)

Product Specifications

Background

This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene may be associated with atrial fibrillation. Alternatively spliced transcript variants encoding the same isoform have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GJA5 Rabbit pAb (APR20083N) .

Synonyms

GJA5; ATFB11; CX40

Gene ID

2702

UniProt

P36382

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, gap junction

Dilution

IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2702

Uniprot URL

https://www.uniprot.org/uniprot/P36382

AA Sequence

LGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Integrin beta 3/CD61 Antibody (ITGB3/1713)
NBP2-53393-20ug 20 µg

Mouse Monoclonal Integrin beta 3/CD61 Antibody (ITGB3/1713)

Sign In for Pricing
View Details
Human Complement Component 3a (C3a) Wide-range ELISA Kit
EKN51643 96 Tests

Human Complement Component 3a (C3a) Wide-range ELISA Kit

Sign In for Pricing
View Details
Syvn1 ORF Vector (Rat) (pORF)
ORF077341 1.0 µg DNA

Syvn1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Olfr1349 CRISPR/Cas9 KO Plasmid (m)
sc-435380 20 µg

Olfr1349 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human GLIPR1/ RTVP1 Protein, His, E.coli-500ug
QP6089-ec-500ug 500ug

Recombinant Human GLIPR1/ RTVP1 Protein, His, E.coli-500ug

Sign In for Pricing
View Details
Recombinant Methanosphaera stadtmanae Undecaprenyl-diphosphatase (uppP)
orb2907500-01 20 µg

Recombinant Methanosphaera stadtmanae Undecaprenyl-diphosphatase (uppP)

Sign In for Pricing
View Details