CYP51A1 Rabbit pAb (APR20074N)
Product Specifications
Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein participates in the synthesis of cholesterol by catalyzing the removal of the 14alpha-methyl group from lanosterol. Homologous genes are found in all three eukaryotic phyla, fungi, plants, and animals, suggesting that this is one of the oldest cytochrome P450 genes. Two transcript variants encoding different isoforms have been found for this gene.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CYP51A1 Rabbit pAb (APR20074N) .
Synonyms
CYP51A1; CP51; CYP51; CYPL1; LDM; P450-14DM; P450L1; CYP51A1
Gene ID
1595
UniProt
Q16850
Cellular Locus
Endoplasmic reticulum membrane, Microsome membrane
Dilution
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 46kDa/56kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1595
Uniprot URL
https://www.uniprot.org/uniprot/Q16850
AA Sequence
LTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC550017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402642-100 1x 100 µL
Prolactin (Pituitary Tumor Marker) (PRL/2642), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040052-100 1x 100 µL
HCG-intact (HCGab/52), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472230-100 1x 100 µL
FOXA1 / HNF3A (FOXA1/2230R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681224-500 1x 500 µL
HCG-beta (HCGb/54+ HCGb/459), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details