Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] CYP3A4 Rabbit pAb (APR20073N)

Product Specifications

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified.

Synonyms

CYP3A4; CP33; CP34; CYP3A; CYP3A3; CYPIIIA3; CYPIIIA4; HLP; NF-25; P450C3; P450PCN1

Gene ID

1576

UniProt

P08684

Cellular Locus

Endoplasmic reticulum membrane, Microsome membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa Observed MW: 57KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] CYP3A4 Rabbit pAb (APR20073N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1576

Uniprot URL

https://www.uniprot.org/uniprot/P08684

AA Sequence

EVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Smooth Muscle Myosin Heavy Chain (SM-MHC)
MBS4380125-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Smooth Muscle Myosin Heavy Chain (SM-MHC)

Ask
View Details
Smooth Muscle Myosin Heavy Chain (SM-MHC)
MBS4380125-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Smooth Muscle Myosin Heavy Chain (SM-MHC)

Ask
View Details
Smooth Muscle Myosin Heavy Chain (SM-MHC)
MBS4380125-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Smooth Muscle Myosin Heavy Chain (SM-MHC)

Ask
View Details
Smooth Muscle Myosin Heavy Chain (SM-MHC)
MBS4380125-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Smooth Muscle Myosin Heavy Chain (SM-MHC)

Ask
View Details
Smooth Muscle Myosin Heavy Chain (SM-MHC)
MBS4380125-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

Smooth Muscle Myosin Heavy Chain (SM-MHC)

Ask
View Details
Alpha SNAP (NAPA) Rabbit Polyclonal Antibody
TA378925 100 µL

Alpha SNAP (NAPA) Rabbit Polyclonal Antibody

Ask
View Details