What is the catalog number for Bmi1 Rabbit pAb (APR20062N)?

The catalog number for Bmi1 Rabbit pAb (APR20062N) is APR20062N.

What sizes are available for Bmi1 Rabbit pAb (APR20062N)?

Bmi1 Rabbit pAb (APR20062N) is available in the following size(s): 50 µL, 100 µL, 200 µL.

How many pack sizes does Bmi1 Rabbit pAb (APR20062N) come in?

Bmi1 Rabbit pAb (APR20062N) is available in 3 different pack sizes.

Is Bmi1 Rabbit pAb (APR20062N) in stock?

Bmi1 Rabbit pAb (APR20062N) is currently made to order / not held in immediate stock. Contact us for lead time.

Bmi1 Rabbit pAb (APR20062N)

Product Specifications

Background

This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1) . This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Bmi1 Rabbit pAb (APR20062N) .

Synonyms

BMI1; FLVI2/BMI1; PCGF4; RNF51; flvi-2/bmi-1; Bmi1

Gene ID

648

UniProt

P35226

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa Observed MW: 41kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=648

Uniprot URL

https://www.uniprot.org/uniprot/P35226

AA Sequence

EDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG