Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF3 Rabbit pAb (APR20058N)

Product Specifications

Background

This gene encodes a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. This gene is induced by a variety of signals, including many of those encountered by cancer cells, and is involved in the complex process of cellular stress response. Multiple transcript variants encoding different isoforms have been found for this gene. It is possible that alternative splicing of this gene may be physiologically important in the regulation of target genes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ATF3 Rabbit pAb (APR20058N) .

Synonyms

ATF3

Gene ID

467

UniProt

P18847

Cellular Locus

Nucleus

Applications

IHC (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/13kDa/14kDa/15kDa/20kDa Observed MW: 23KDa/24KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=467

Uniprot URL

https://www.uniprot.org/uniprot/P18847

AA Sequence

MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GMEB2 siRNA
abx918110-01 15 nmol

Mouse GMEB2 siRNA

Sign In for Pricing
View Details
Mouse GMEB2 siRNA
abx918110-02 30 nmol

Mouse GMEB2 siRNA

Sign In for Pricing
View Details
Rabbit Monoclonal CD79B Antibody (IGB/2940R) [Alexa Fluor 700]
NBP3-08358AF700 100 µL

Rabbit Monoclonal CD79B Antibody (IGB/2940R) [Alexa Fluor 700]

Sign In for Pricing
View Details
ELISA Kit for Heat Shock Protein Beta 6 (HSPb6)
TRV-0045304-01 24 Tests

ELISA Kit for Heat Shock Protein Beta 6 (HSPb6)

Sign In for Pricing
View Details
ELISA Kit for Heat Shock Protein Beta 6 (HSPb6)
TRV-0045304-02 48 Tests

ELISA Kit for Heat Shock Protein Beta 6 (HSPb6)

Sign In for Pricing
View Details
ELISA Kit for Heat Shock Protein Beta 6 (HSPb6)
TRV-0045304-03 96 Tests

ELISA Kit for Heat Shock Protein Beta 6 (HSPb6)

Sign In for Pricing
View Details