Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMPD3 Rabbit pAb (APR20053N)

Product Specifications

Background

This gene encodes a member of the AMP deaminase gene family. The encoded protein is a highly regulated enzyme that catalyzes the hydrolytic deamination of adenosine monophosphate to inosine monophosphate, a branch point in the adenylate catabolic pathway. This gene encodes the erythrocyte (E) isoforms, whereas other family members encode isoforms that predominate in muscle (M) and liver (L) cells. Mutations in this gene lead to the clinically asymptomatic, autosomal recessive condition erythrocyte AMP deaminase deficiency. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AMPD3 Rabbit pAb (APR20053N) .

Synonyms

AMPD3

Gene ID

272

UniProt

Q01432

Dilution

IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/71kDa/76kDa/88kDa/89kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=272

Uniprot URL

https://www.uniprot.org/uniprot/Q01432

AA Sequence

MALSSEPAEMPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQKELAEQKSVETAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATSLPTPAPYAMPEFQRVTISGDYCAGITLEDYEQAAKSLAKALMIREKYARLAYHRFPRITSQYLGHPRADTAPPEEGLPDFHPPPLPQEDPYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sonic Hedgehog N-Terminus (Shh-N), CF
PR15019CF 25 µg

Sonic Hedgehog N-Terminus (Shh-N), CF

Sign In for Pricing
View Details
Mouse Inpp1 Pre-designed siRNA Set A
SI106719A 1 Each

Mouse Inpp1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Methyl 2-[2- (trimethylsilyl) ethynyl]benzoate
OR1080354-01 250 mg

Methyl 2-[2- (trimethylsilyl) ethynyl]benzoate

Sign In for Pricing
View Details
Methyl 2-[2- (trimethylsilyl) ethynyl]benzoate
OR1080354-02 1 g

Methyl 2-[2- (trimethylsilyl) ethynyl]benzoate

Sign In for Pricing
View Details
ENPP2 Polyclonal Antibody
E-AB-19626-01 20 µL

ENPP2 Polyclonal Antibody

Sign In for Pricing
View Details
ENPP2 Polyclonal Antibody
E-AB-19626-02 60 µL

ENPP2 Polyclonal Antibody

Sign In for Pricing
View Details