Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (APR20048N)

Product Specifications

Background

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb (APR20048N) .

Synonyms

HMOX1; HMOX1D; HO-1; HSP32; bK286B10

Gene ID

3162

UniProt

P09601

Cellular Locus

Cytoplasmic side, Endoplasmic reticulum membrane, Microsome, Peripheral membrane protein

Applications

WB (Mouse liver, Homo sapiens, Mus musculus, Vaccinium dunalianum, Rattus norvegicus, Struthio camelus, Cyprinus carpio, Gallus gallus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 32kDa Observed MW: 33KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3162

Uniprot URL

https://www.uniprot.org/uniprot/P09601

AA Sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human MSLN Antibody (SAA0146), FITC
HC496217-01 1 Each

Anti-Human MSLN Antibody (SAA0146), FITC

Sign In for Pricing
View Details
Anti-Human MSLN Antibody (SAA0146), FITC
HC496217-02 100 Tests

Anti-Human MSLN Antibody (SAA0146), FITC

Sign In for Pricing
View Details
Mms22l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4818306 1.0 µg DNA

Mms22l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
GAP43 Recombinant Monoclonal Antibody
RAC08233-01 50 µL

GAP43 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
GAP43 Recombinant Monoclonal Antibody
RAC08233-02 100 µL

GAP43 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
GRK 2 (phospho Ser685) Polyclonal Antibody
MBS9242200-01 0.1 mL

GRK 2 (phospho Ser685) Polyclonal Antibody

Sign In for Pricing
View Details