Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIM-3/HAVCR2 Rabbit pAb (APR20032N)

Product Specifications

Background

The protein encoded by this gene belongs to the immunoglobulin superfamily, and TIM family of proteins. CD4-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas, Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. This protein is a Th1-specific cell surface protein that regulates macrophage activation, and inhibits Th1-mediated auto- and alloimmune responses, and promotes immunological tolerance.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TIM-3/HAVCR2 Rabbit pAb (APR20032N) .

Synonyms

HAVCR2; CD366; HAVcr-2; KIM-3; TIM3; TIMD-3; TIMD3; Tim-3

Gene ID

84868

UniProt

Q8TDQ0

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 85kDa/100kDa/105kDa/106kDa Observed MW: 45-70KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84868

Uniprot URL

https://www.uniprot.org/uniprot/Q8TDQ0

AA Sequence

MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCS-21311
MBS6096906-01 10 mg

TCS-21311

Sign In for Pricing
View Details
TCS-21311
MBS6096906-02 5x 10 mg

TCS-21311

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) Os07g0613300 Polyclonal Antibody
MBS9002265 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os07g0613300 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: left
CS714382 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
SFRS1, CT (Splicing Factor, Arginine/Serine-rich 1, pre-mRNA-splicing Factor SF2, P33 Subunit, Alternative-splicing Factor 1, ASF-1, OK/SW-cl.3, SF2P33, SF2, ASF) (MaxLight 650) discontinued
S5554-50B-ML650 100 µL

SFRS1, CT (Splicing Factor, Arginine/Serine-rich 1, pre-mRNA-splicing Factor SF2, P33 Subunit, Alternative-splicing Factor 1, ASF-1, OK/SW-cl.3, SF2P33, SF2, ASF) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Human adrenergic beta-1receptor, ADRB1 ELISA Kit
SL3361Hu-01 96 Tests

Human adrenergic beta-1receptor, ADRB1 ELISA Kit

Sign In for Pricing
View Details