Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPF2 Rabbit pAb (APR20004N)

Product Specifications

Background

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD) . When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located in the perinuclear area. It interacts with translation release factors and the proteins that are functional homologs of yeast Upf1p and Upf3p. Two splice variants have been found for this gene; both variants encode the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UPF2 Rabbit pAb (APR20004N) .

Synonyms

UPF2; HUPF2; RENT2; smg-3

Gene ID

26019

UniProt

Q9HAU5

Cellular Locus

Cytoplasm, perinuclear region

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 66kDa/147kDa Observed MW: 180kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26019

Uniprot URL

https://www.uniprot.org/uniprot/Q9HAU5

AA Sequence

GPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ITM2C antibody
STJ113597 100 µl

Anti-ITM2C antibody

Sign In for Pricing
View Details
Phykpl (NM_028398) Mouse Tagged Lenti ORF Clone
MR207465L3 10 µg

Phykpl (NM_028398) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
4- (2,2,2-Trifluoroethoxy) nitrobenzene
PC6675-01 250 mg

4- (2,2,2-Trifluoroethoxy) nitrobenzene

Sign In for Pricing
View Details
4- (2,2,2-Trifluoroethoxy) nitrobenzene
PC6675-02 1 g

4- (2,2,2-Trifluoroethoxy) nitrobenzene

Sign In for Pricing
View Details
4- (2,2,2-Trifluoroethoxy) nitrobenzene
PC6675-03 5 g

4- (2,2,2-Trifluoroethoxy) nitrobenzene

Sign In for Pricing
View Details
4- (2,2,2-Trifluoroethoxy) nitrobenzene
PC6675-04 25 g

4- (2,2,2-Trifluoroethoxy) nitrobenzene

Sign In for Pricing
View Details