Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD226 Rabbit pAb (APR19990N)

Product Specifications

Background

This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD226 Rabbit pAb (APR19990N) .

Synonyms

CD226; DNAM-1; DNAM1; PTA1; TLiSA1

Gene ID

10666

UniProt

Q15762

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 38kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10666

Uniprot URL

https://www.uniprot.org/uniprot/Q15762

AA Sequence

EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNYRSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRP3 Antibody
DF7502-01 100 µL

NLRP3 Antibody

Sign In for Pricing
View Details
NLRP3 Antibody
DF7502-02 200 µL

NLRP3 Antibody

Sign In for Pricing
View Details
GNL1 Polyclonal Antibody
MBS2574100-01 0.06 mL

GNL1 Polyclonal Antibody

Sign In for Pricing
View Details
GNL1 Polyclonal Antibody
MBS2574100-02 0.12 mL

GNL1 Polyclonal Antibody

Sign In for Pricing
View Details
GNL1 Polyclonal Antibody
MBS2574100-03 0.2 mL

GNL1 Polyclonal Antibody

Sign In for Pricing
View Details
GNL1 Polyclonal Antibody
MBS2574100-04 5x 0.2 mL

GNL1 Polyclonal Antibody

Sign In for Pricing
View Details