Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCEB2 Rabbit pAb (APR19955N)

Product Specifications

Background

This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TCEB2 Rabbit pAb (APR19955N) .

Synonyms

ELOB; SIII; TCEB2; elongin-B

Gene ID

6923

UniProt

Q15370

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:20 - 1:50

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/17kDa Observed MW: 16kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6923

Uniprot URL

https://www.uniprot.org/uniprot/Q15370

AA Sequence

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAPG Rabbit Polyclonal Antibody
E10G32713 100 µL

NAPG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Neutral Sphingomyelinase (NSMASE) Magnetic Luminex Assay Kit
LKU603755 96 Tests

Neutral Sphingomyelinase (NSMASE) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
N-Propargylphthalimide
sc-236088 5 g

N-Propargylphthalimide

Sign In for Pricing
View Details
Mouse monoclonal antibody to HCV subtype 1b NS5B protein
orb1108679-01 100 µg

Mouse monoclonal antibody to HCV subtype 1b NS5B protein

Sign In for Pricing
View Details
Mouse monoclonal antibody to HCV subtype 1b NS5B protein
orb1108679-02 500 µg

Mouse monoclonal antibody to HCV subtype 1b NS5B protein

Sign In for Pricing
View Details
Mouse monoclonal antibody to HCV subtype 1b NS5B protein
orb1108679-03 1 mg

Mouse monoclonal antibody to HCV subtype 1b NS5B protein

Sign In for Pricing
View Details