Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS Rabbit pAb (APR19942N)

Product Specifications

Background

This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts. Multiple alternatively spliced transcript variants have been described but the biological validity of all variants is unknown.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SARS Rabbit pAb (APR19942N) .

Synonyms

SARS; SERRS; SERS

Gene ID

6301

UniProt

P49591

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 58kDa Observed MW: 59kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6301

Uniprot URL

https://www.uniprot.org/uniprot/P49591

AA Sequence

MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DC-SIGN (Dendritic Cell-specific ICAM3 grabbing Non-integrin, C Type Lectin Domain Family 4 Member L, CLEC4L, CD209, CD209 Antigen, CDSIGN, Dendritic Cell-specific ICAM-3-grabbing Non-integrin 1, DC SIGN1, DC-SIGN1, HIV GP120 Binding Protein, MGC129965) (
MBS6252775-01 0.1 mL

DC-SIGN (Dendritic Cell-specific ICAM3 grabbing Non-integrin, C Type Lectin Domain Family 4 Member L, CLEC4L, CD209, CD209 Antigen, CDSIGN, Dendritic Cell-specific ICAM-3-grabbing Non-integrin 1, DC SIGN1, DC-SIGN1, HIV GP120 Binding Protein, MGC129965) (

Sign In for Pricing
View Details
DC-SIGN (Dendritic Cell-specific ICAM3 grabbing Non-integrin, C Type Lectin Domain Family 4 Member L, CLEC4L, CD209, CD209 Antigen, CDSIGN, Dendritic Cell-specific ICAM-3-grabbing Non-integrin 1, DC SIGN1, DC-SIGN1, HIV GP120 Binding Protein, MGC129965) (
MBS6252775-02 5x 0.1 mL

DC-SIGN (Dendritic Cell-specific ICAM3 grabbing Non-integrin, C Type Lectin Domain Family 4 Member L, CLEC4L, CD209, CD209 Antigen, CDSIGN, Dendritic Cell-specific ICAM-3-grabbing Non-integrin 1, DC SIGN1, DC-SIGN1, HIV GP120 Binding Protein, MGC129965) (

Sign In for Pricing
View Details
N-​[4-​[ (4-​Methoxyphenyl) ​amino]​phenyl]​acetamide
457789-01 50 mg

N-​[4-​[ (4-​Methoxyphenyl) ​amino]​phenyl]​acetamide

Sign In for Pricing
View Details
N-​[4-​[ (4-​Methoxyphenyl) ​amino]​phenyl]​acetamide
457789-02 250 mg

N-​[4-​[ (4-​Methoxyphenyl) ​amino]​phenyl]​acetamide

Sign In for Pricing
View Details
Rat CSTB (Cystatin B) ELISA Kit
MBS8804539-01 48 Well

Rat CSTB (Cystatin B) ELISA Kit

Sign In for Pricing
View Details
Rat CSTB (Cystatin B) ELISA Kit
MBS8804539-02 96 Well

Rat CSTB (Cystatin B) ELISA Kit

Sign In for Pricing
View Details