Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM1 Rabbit pAb (APR19939N)

Product Specifications

Background

This gene encodes the large and catalytic subunit of ribonucleotide reductase, an enzyme essential for the conversion of ribonucleotides into deoxyribonucleotides. A pool of available deoxyribonucleotides is important for DNA replication during S phase of the cell cycle as well as multiple DNA repair processes. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RRM1 Rabbit pAb (APR19939N) .

Synonyms

RRM1; R1; RIR1; RR1

Gene ID

6240

UniProt

P23921

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200 IP 1:20 - 1:50

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 90kDa Observed MW: 95kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6240

Uniprot URL

https://www.uniprot.org/uniprot/P23921

AA Sequence

IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP3A5, CT (Cytochrome P450 3A5, CYPIIIA5, Cytochrome P450-PCN3, Cytochrome P450 HLp2) (MaxLight 405) discontinued
C9095-17B2-ML405 100 µL

CYP3A5, CT (Cytochrome P450 3A5, CYPIIIA5, Cytochrome P450-PCN3, Cytochrome P450 HLp2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Zona pellucida glycoprotein 4 Rabbit pAb, IRDye 800CW conjugated
orb2886510 100 µL

Zona pellucida glycoprotein 4 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
RSPH10B2 (NM_001099697) Human Tagged ORF Clone Lentiviral Particle
RC221344L3V 200 µL

RSPH10B2 (NM_001099697) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RelB Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-3562R-APC-Cy5.5 100 µL

RelB Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
UNC5D Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-11494R-BF405 100 µL

UNC5D Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
(16aR) -1,16-Bis (diphenylphosphino) -6,7,8,9,10,11-hexahydrodibenzo[b, d][1,6]dioxacyclododecine
OR1060124-01 100 mg

(16aR) -1,16-Bis (diphenylphosphino) -6,7,8,9,10,11-hexahydrodibenzo[b, d][1,6]dioxacyclododecine

Sign In for Pricing
View Details