Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM1 Rabbit pAb (APR19939N)

Product Specifications

Background

This gene encodes the large and catalytic subunit of ribonucleotide reductase, an enzyme essential for the conversion of ribonucleotides into deoxyribonucleotides. A pool of available deoxyribonucleotides is important for DNA replication during S phase of the cell cycle as well as multiple DNA repair processes. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RRM1 Rabbit pAb (APR19939N) .

Synonyms

RRM1; R1; RIR1; RR1

Gene ID

6240

UniProt

P23921

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200 IP 1:20 - 1:50

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 90kDa Observed MW: 95kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6240

Uniprot URL

https://www.uniprot.org/uniprot/P23921

AA Sequence

IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5E Protein Vector (Human) (pPM-N-D-C-His)
PV325129 500 ng

ATP5E Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal anti-Rat CD11a Antibody
xAP-0868 100 µg

Mouse Monoclonal anti-Rat CD11a Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ROCK2 Antibody [mFluor Violet 610 SE]
NBP1-76570MFV610 0.1 mL

Rabbit Polyclonal ROCK2 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
ZNF575 AAV siRNA Pooled Vector
51631161 1.0 µg

ZNF575 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Mouse IGF2 Protein, N-His
MF572012-01 50 µg

Recombinant Mouse IGF2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse IGF2 Protein, N-His
MF572012-02 100 µg

Recombinant Mouse IGF2 Protein, N-His

Sign In for Pricing
View Details