Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL12RB1 Rabbit pAb (APR19911N)

Product Specifications

Background

The protein encoded by this gene is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. This protein binds to interleukine 12 (IL12) with a low affinity, and is thought to be a part of IL12 receptor complex. This protein forms a disulfide-linked oligomer, which is required for its IL12 binding activity. The coexpression of this and IL12RB2 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. Mutations in this gene impair the development of interleukin-17-producing T lymphocytes and result in increased susceptibility to mycobacterial and Salmonella infections. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IL12RB1 Rabbit pAb (APR19911N) .

Synonyms

IL12RB1; CD212; IL-12R-BETA1; IL12RB; IMD30

Gene ID

3594

UniProt

P42701

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa/72kDa/73kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3594

Uniprot URL

https://www.uniprot.org/uniprot/P42701

AA Sequence

RTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)
MBS1033223-01 0.02 mg (E-Coli)

Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)

Sign In for Pricing
View Details
Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)
MBS1033223-02 0.02 mg (Yeast)

Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)

Sign In for Pricing
View Details
Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)
MBS1033223-03 0.1 mg (E-Coli)

Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)

Sign In for Pricing
View Details
Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)
MBS1033223-04 0.1 mg (Yeast)

Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)

Sign In for Pricing
View Details
Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)
MBS1033223-05 0.02 mg (Baculovirus)

Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)

Sign In for Pricing
View Details
Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)
MBS1033223-06 0.02 mg (Mammalian-Cell)

Recombinant Acidovorax ebreus HPr kinase/phosphorylase (hprK)

Sign In for Pricing
View Details