Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD68 Rabbit pAb (APR19880N)

Product Specifications

Background

This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD68 Rabbit pAb (APR19880N) .

Synonyms

CD68; GP110; LAMP4; SCARD1

Gene ID

968

UniProt

P34810

Cellular Locus

Cell membrane, Endosome membrane, Lysosome membrane, Single-pass type I membrane protein, Single-pass type I membrane protein

Applications

IF (Rattus norvegicus, Homo sapiens, Mus musculus) WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/34kDa/37kDa Observed MW: 80-130KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=968

Uniprot URL

https://www.uniprot.org/uniprot/P34810

AA Sequence

NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC38A6 (NM_153811) Human Tagged ORF Clone Lentiviral Particle
RC210307L3V 200 µL

SLC38A6 (NM_153811) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Thyroid hormone receptor alpha Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-6221R-BF647-01 20 µL

Thyroid hormone receptor alpha Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Thyroid hormone receptor alpha Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-6221R-BF647-02 100 µL

Thyroid hormone receptor alpha Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Human Surfactant Protein D (SP-D) ELISA Kit
201-12-1075 96 Tests

Human Surfactant Protein D (SP-D) ELISA Kit

Sign In for Pricing
View Details
ARMC8 ORF Vector (Human) (pORF)
12417011 1.0 µg DNA

ARMC8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Tert-Butyl 2- (3- (trifluoromethyl) phenyl) morpholine-4-carboxylate
PC1002616-01 100 mg

Tert-Butyl 2- (3- (trifluoromethyl) phenyl) morpholine-4-carboxylate

Sign In for Pricing
View Details