Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN8 Rabbit pAb (APR19863N)

Product Specifications

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TSPAN8 Rabbit pAb (APR19863N) .

Synonyms

TSPAN8; CO-029; TM4SF3

Gene ID

7103

UniProt

P19075

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa Observed MW: 26kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7103

Uniprot URL

https://www.uniprot.org/uniprot/P19075

AA Sequence

KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKD

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LUM (Lumican, LDC, Keratan Sulfate Proteoglycan Lumican, KSPG Lumican, SLRR2D) (MaxLight 405)
MBS6485555-01 0.1 mL

LUM (Lumican, LDC, Keratan Sulfate Proteoglycan Lumican, KSPG Lumican, SLRR2D) (MaxLight 405)

Ask
View Details
LUM (Lumican, LDC, Keratan Sulfate Proteoglycan Lumican, KSPG Lumican, SLRR2D) (MaxLight 405)
MBS6485555-02 5x 0.1 mL

LUM (Lumican, LDC, Keratan Sulfate Proteoglycan Lumican, KSPG Lumican, SLRR2D) (MaxLight 405)

Ask
View Details
RBBP7, ID (RBBP7, RBAP46, Histone-binding protein RBBP7, Histone acetyltransferase type B subunit 2, Nucleosome-remodeling factor subunit RBAP46, Retinoblastoma-binding protein 7, Retinoblastoma-binding protein p46) (MaxLight 750)
MBS6340617-01 0.1 mL

RBBP7, ID (RBBP7, RBAP46, Histone-binding protein RBBP7, Histone acetyltransferase type B subunit 2, Nucleosome-remodeling factor subunit RBAP46, Retinoblastoma-binding protein 7, Retinoblastoma-binding protein p46) (MaxLight 750)

Ask
View Details
RBBP7, ID (RBBP7, RBAP46, Histone-binding protein RBBP7, Histone acetyltransferase type B subunit 2, Nucleosome-remodeling factor subunit RBAP46, Retinoblastoma-binding protein 7, Retinoblastoma-binding protein p46) (MaxLight 750)
MBS6340617-02 5x 0.1 mL

RBBP7, ID (RBBP7, RBAP46, Histone-binding protein RBBP7, Histone acetyltransferase type B subunit 2, Nucleosome-remodeling factor subunit RBAP46, Retinoblastoma-binding protein 7, Retinoblastoma-binding protein p46) (MaxLight 750)

Ask
View Details
Mouse Dynein light chain roadblock-type 2, DYNLRB2 ELISA Kit
MBS9316773-01 48 Well

Mouse Dynein light chain roadblock-type 2, DYNLRB2 ELISA Kit

Ask
View Details
Mouse Dynein light chain roadblock-type 2, DYNLRB2 ELISA Kit
MBS9316773-02 96 Well

Mouse Dynein light chain roadblock-type 2, DYNLRB2 ELISA Kit

Ask
View Details