Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM11 Rabbit pAb (APR19815N)

Product Specifications

Background

Tissue-specific splicing factor with potential implication in the regulation of alternative splicing during neuron and germ cell differentiation. Antagonizes SRSF1-mediated BCL-X splicing. May affect the choice of alternative 5' splice sites by binding to specific sequences in exons and antagonizing the SR protein SRSF1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RBM11 Rabbit pAb (APR19808N6) .

Synonyms

RBM11

Gene ID

54033

UniProt

P57052

Cellular Locus

Nucleus, Nucleus speckle, nucleoplasm

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/32kDa Observed MW: 32kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54033

Uniprot URL

https://www.uniprot.org/uniprot/P57052

AA Sequence

MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLPQEYFLFQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCKAP1L Protein Vector (Mouse) (pPM-C-His)
PV204373 500 ng

NCKAP1L Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
hnRNP R (HNRNPR) (NM_001102397) Human Tagged Lenti ORF Clone
RC224683L4 10 µg

hnRNP R (HNRNPR) (NM_001102397) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BMP/Retinoic Acid Inducible Neural Specific 2 (BRINP2) Antibody (HRP)
abx310929-01 20 µg

BMP/Retinoic Acid Inducible Neural Specific 2 (BRINP2) Antibody (HRP)

Sign In for Pricing
View Details
BMP/Retinoic Acid Inducible Neural Specific 2 (BRINP2) Antibody (HRP)
abx310929-02 50 µg

BMP/Retinoic Acid Inducible Neural Specific 2 (BRINP2) Antibody (HRP)

Sign In for Pricing
View Details
BMP/Retinoic Acid Inducible Neural Specific 2 (BRINP2) Antibody (HRP)
abx310929-03 100 µg

BMP/Retinoic Acid Inducible Neural Specific 2 (BRINP2) Antibody (HRP)

Sign In for Pricing
View Details
BMP/Retinoic Acid Inducible Neural Specific 2 (BRINP2) Antibody (HRP)
abx310929-04 200 µg

BMP/Retinoic Acid Inducible Neural Specific 2 (BRINP2) Antibody (HRP)

Sign In for Pricing
View Details