Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRNP35 Rabbit pAb (APR19810N)

Product Specifications

Background

The protein encoded by this gene is a homolog of the U1-snRNP binding protein. The N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, which is a characteristic of a variety of splicing factors. This protein is a component of the U11/U12 small nuclear ribonucleoproteins (snRNP) that form part of the U12-type spliceosome. Alternative splicing results in multiple transcript variants encoding two distinct isoforms and representing a non-protein coding variant.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SNRNP35 Rabbit pAb (APR19808N1) .

Synonyms

SNRNP35; HM-1; U1SNRNPBP

Gene ID

11066

UniProt

Q16560

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11066

Uniprot URL

https://www.uniprot.org/uniprot/Q16560

AA Sequence

MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VGFR2 (KDR, FLK1, VEGFR2, Vascular endothelial growth factor receptor 2, Fetal liver kinase 1, Kinase insert domain receptor, Protein-tyrosine kinase receptor flk-1) (MaxLight 550) discontinued
043751-ML550 100 µL

VGFR2 (KDR, FLK1, VEGFR2, Vascular endothelial growth factor receptor 2, Fetal liver kinase 1, Kinase insert domain receptor, Protein-tyrosine kinase receptor flk-1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1)
MBS642709-01 0.05 mg

DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1)

Sign In for Pricing
View Details
DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1)
MBS642709-02 5x 0.05 mg

DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1)

Sign In for Pricing
View Details
Adad1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3655402 1.0 µg DNA

Adad1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human Kidney injury molecule 1,Kim-1 ELISA Kit
CN-03802H2 48T

Human Kidney injury molecule 1,Kim-1 ELISA Kit

Sign In for Pricing
View Details
TMEM183A Protein Vector (Rat) (pPM-C-HA)
PV311516 500 ng

TMEM183A Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details