Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC29A1 Rabbit pAb (APR19803N)

Product Specifications

Background

This gene is a member of the equilibrative nucleoside transporter family. The gene encodes a transmembrane glycoprotein that localizes to the plasma and mitochondrial membranes and mediates the cellular uptake of nucleosides from the surrounding medium. The protein is categorized as an equilibrative (as opposed to concentrative) transporter that is sensitive to inhibition by nitrobenzylthioinosine (NBMPR) . Nucleoside transporters are required for nucleotide synthesis in cells that lack de novo nucleoside synthesis pathways, and are also necessary for the uptake of cytotoxic nucleosides used for cancer and viral chemotherapies. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC29A1 Rabbit pAb (APR19803N) .

Synonyms

SLC29A1; ENT1

Gene ID

2030

UniProt

Q99808

Cellular Locus

Apical cell membrane, Basolateral cell membrane, Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa/58kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2030

Uniprot URL

https://www.uniprot.org/uniprot/Q99808

AA Sequence

ELSESAFGYFITACAVIILTIICYLGLPRLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILKNISVLAFSVCFIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLRB (NM_001166060) Human Tagged Lenti ORF Clone
RC228928L2 10 µg

GLRB (NM_001166060) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PLEC Protein Vector (Mouse) (pPB-C-His)
PV216966 500 ng

PLEC Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
SR-B2/LIMPII Rabbit pAb
E45R26393N-100 100 µL

SR-B2/LIMPII Rabbit pAb

Sign In for Pricing
View Details
Rat MAP3K12 siRNA
abx923436-01 15 nmol

Rat MAP3K12 siRNA

Sign In for Pricing
View Details
Rat MAP3K12 siRNA
abx923436-02 30 nmol

Rat MAP3K12 siRNA

Sign In for Pricing
View Details
Pidotimod Impurity D
RM-P136004-01 10 mg

Pidotimod Impurity D

Sign In for Pricing
View Details