Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTRT3 Rabbit pAb (APR19796N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ACTRT3 Rabbit pAb (APR19796N) .

Synonyms

ACTRT3; ARP-T3; ARPM1

Gene ID

84517

UniProt

Q9BYD9

Cellular Locus

Cytoplasm, Nucleus, cytoskeleton

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 41kDa Observed MW: 41kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84517

Uniprot URL

https://www.uniprot.org/uniprot/Q9BYD9

AA Sequence

MNHCQLPVVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-10 Antibody (Biotin)
orb1216851 50 µg

IL-10 Antibody (Biotin)

Sign In for Pricing
View Details
GFAP Recombinant Rabbit mAb, Cy3 conjugated
orb3164056 100 µL

GFAP Recombinant Rabbit mAb, Cy3 conjugated

Sign In for Pricing
View Details
Cyclin D3 (BSA & Azide Free) (CCNE 1, CCNE, Cyclin E1, Cyclin Es, Cyclin Et, G1/S specific cyclin E, CCND3) (MaxLight 650)
MBS6267787-01 0.1 mL

Cyclin D3 (BSA & Azide Free) (CCNE 1, CCNE, Cyclin E1, Cyclin Es, Cyclin Et, G1/S specific cyclin E, CCND3) (MaxLight 650)

Sign In for Pricing
View Details
Cyclin D3 (BSA & Azide Free) (CCNE 1, CCNE, Cyclin E1, Cyclin Es, Cyclin Et, G1/S specific cyclin E, CCND3) (MaxLight 650)
MBS6267787-02 5x 0.1 mL

Cyclin D3 (BSA & Azide Free) (CCNE 1, CCNE, Cyclin E1, Cyclin Es, Cyclin Et, G1/S specific cyclin E, CCND3) (MaxLight 650)

Sign In for Pricing
View Details
VENTX, ID (VENTX, HPX42B, VENTX2, Homeobox protein VENTX, VENT homeobox homolog, VENT-like homeobox protein 2) (Azide free) (HRP) discontinued
043748-HRP 200 µL

VENTX, ID (VENTX, HPX42B, VENTX2, Homeobox protein VENTX, VENT homeobox homolog, VENT-like homeobox protein 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Photobacterium profundum Protein syd (syd)
MBS1479171-01 0.02 mg (E-Coli)

Recombinant Photobacterium profundum Protein syd (syd)

Sign In for Pricing
View Details