Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC9 Rabbit pAb (APR19774N)

Product Specifications

Background

Acts as a dual histone chaperone and heat shock co-chaperone. As a histone chaperone, forms a co-chaperone complex with MCM2 and histone H3-H4 heterodimers; and may thereby assist MCM2 in histone H3-H4 heterodimer recognition and facilitate the assembly of histones into nucleosomes. May also act as a histone co-chaperone together with TONSL. May recruit histone chaperones ASF1A, NASP and SPT2 to histone H3-H4 heterodimers. Also plays a role as co-chaperone of the HSP70 family of molecular chaperone proteins, such as HSPA1A, HSPA1B and HSPA8. As a co-chaperone, may play a role in the recruitment of HSP70-type molecular chaperone machinery to histone H3-H4 substrates, thereby maintaining the histone structural integrity. Exhibits activity to assemble histones onto DNA in vitro.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DNAJC9 Rabbit pAb (APR19774N) .

Synonyms

DNAJC9; HDJC9; JDD1; SB73

Gene ID

23234

UniProt

Q8WXX5

Cellular Locus

Cell membrane, Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23234

Uniprot URL

https://www.uniprot.org/uniprot/Q8WXX5

AA Sequence

MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis B Virus X-protein (Trans-activator X Gene Product)
H1916-02 100 µg

Hepatitis B Virus X-protein (Trans-activator X Gene Product)

Sign In for Pricing
View Details
Anti-Fc epsilon RI gamma Antibody
MBS8306653-01 0.03 mL

Anti-Fc epsilon RI gamma Antibody

Sign In for Pricing
View Details
Anti-Fc epsilon RI gamma Antibody
MBS8306653-02 0.05 mL

Anti-Fc epsilon RI gamma Antibody

Sign In for Pricing
View Details
Anti-Fc epsilon RI gamma Antibody
MBS8306653-03 0.1 mL

Anti-Fc epsilon RI gamma Antibody

Sign In for Pricing
View Details
Anti-Fc epsilon RI gamma Antibody
MBS8306653-04 0.2 mL

Anti-Fc epsilon RI gamma Antibody

Sign In for Pricing
View Details
Anti-Fc epsilon RI gamma Antibody
MBS8306653-05 5x 0.2 mL

Anti-Fc epsilon RI gamma Antibody

Sign In for Pricing
View Details