Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARVB Rabbit pAb (APR19759N)

Product Specifications

Background

This gene encodes a member of the parvin family of actin-binding proteins, which play a role in cytoskeleton organization and cell adhesion. These proteins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. This family member binds to alphaPIX and alpha-actinin, and it can inhibit the activity of integrin-linked kinase. This protein also functions in tumor suppression. Alternative splicing of this gene results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PARVB Rabbit pAb (APR19759N) .

Synonyms

PARVB; CGI-56

Gene ID

29780

UniProt

Q9HBI1

Cellular Locus

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, Z line, cytoskeleton, focal adhesion, lamellipodium, myofibril, sarcomere

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa/41kDa/45kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29780

Uniprot URL

https://www.uniprot.org/uniprot/Q9HBI1

AA Sequence

MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Kidney
CR562811 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Recombinant Human SerpinA5/SERPINA5 Protein (His Tag)
PKSH033034-01 10 µg

Recombinant Human SerpinA5/SERPINA5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SerpinA5/SERPINA5 Protein (His Tag)
PKSH033034-02 50 µg

Recombinant Human SerpinA5/SERPINA5 Protein (His Tag)

Sign In for Pricing
View Details
MOBKL2B (MOB3B) Rabbit Polyclonal Antibody
TA368293 100 µL

MOBKL2B (MOB3B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Duodenum
CS506672 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/2049R), CF640R conjugate, 0.1mg/mL
BNC402049-100 1x 100 µL

CD43 (T-Cell Marker) (SPN/2049R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details