Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX5 Rabbit pAb (APR19758N)

Product Specifications

Background

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein functions in endosomal sorting, the phosphoinositide-signaling pathway, and macropinocytosis. This gene may play a role in the tumorigenesis of papillary thyroid carcinoma. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SNX5 Rabbit pAb (APR19758N) .

Synonyms

SNX5

Gene ID

27131

UniProt

Q9Y5X3

Cellular Locus

Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle membrane, Early endosome, Early endosome membrane, Endosome, Peripheral membrane protein, phagocytic cup, ruffle

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/46kDa Observed MW: 47kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=27131

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y5X3

AA Sequence

VFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GNRPX (Pleckstrin Homology Domain-containing Family J Member 1, PH Domain-containing Family J Member 1, Guanine Nucleotide-releasing Protein X, PLEKHJ1)
MBS641234-01 0.1 mg

GNRPX (Pleckstrin Homology Domain-containing Family J Member 1, PH Domain-containing Family J Member 1, Guanine Nucleotide-releasing Protein X, PLEKHJ1)

Ask
View Details
GNRPX (Pleckstrin Homology Domain-containing Family J Member 1, PH Domain-containing Family J Member 1, Guanine Nucleotide-releasing Protein X, PLEKHJ1)
MBS641234-02 5x 0.1 mg

GNRPX (Pleckstrin Homology Domain-containing Family J Member 1, PH Domain-containing Family J Member 1, Guanine Nucleotide-releasing Protein X, PLEKHJ1)

Ask
View Details
SERPINE2, ID (SERPINE2, PI7, PN1, Glia-derived nexin, Peptidase inhibitor 7, Protease nexin 1, Protease nexin I, Serpin E2) (MaxLight 550) discontinued
041586-ML550 100 µL

SERPINE2, ID (SERPINE2, PI7, PN1, Glia-derived nexin, Peptidase inhibitor 7, Protease nexin 1, Protease nexin I, Serpin E2) (MaxLight 550) discontinued

Ask
View Details
Recombinant Arabidopsis thaliana Probable root meristem growth factor 8 (RGF8)
MBS7100514-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Probable root meristem growth factor 8 (RGF8)

Ask
View Details
Recombinant Arabidopsis thaliana Probable root meristem growth factor 8 (RGF8)
MBS7100514-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Probable root meristem growth factor 8 (RGF8)

Ask
View Details
Recombinant Arabidopsis thaliana Probable root meristem growth factor 8 (RGF8)
MBS7100514-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Probable root meristem growth factor 8 (RGF8)

Ask
View Details