Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX5 Rabbit pAb (APR19758N)

Product Specifications

Background

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein functions in endosomal sorting, the phosphoinositide-signaling pathway, and macropinocytosis. This gene may play a role in the tumorigenesis of papillary thyroid carcinoma. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SNX5 Rabbit pAb (APR19758N) .

Synonyms

SNX5

Gene ID

27131

UniProt

Q9Y5X3

Cellular Locus

Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle membrane, Early endosome, Early endosome membrane, Endosome, Peripheral membrane protein, phagocytic cup, ruffle

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/46kDa Observed MW: 47kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=27131

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y5X3

AA Sequence

VFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPN5 Recombinant Protein (Human)
RP041860 100 µg

OPN5 Recombinant Protein (Human)

Sign In for Pricing
View Details
PD 117519 10mg
A20388-10 10 mg

PD 117519 10mg

Sign In for Pricing
View Details
Rat Monoclonal MAdCAM-1 Antibody (RM0284-11A55) [Alexa Fluor 405]
NBP2-11785AF405 0.1 mL

Rat Monoclonal MAdCAM-1 Antibody (RM0284-11A55) [Alexa Fluor 405]

Sign In for Pricing
View Details
Anti-Mouse CD64 Monoclonal Antibody (PE/Cyanine5 Conjugated)
MBS2559343-01 0.025 mg

Anti-Mouse CD64 Monoclonal Antibody (PE/Cyanine5 Conjugated)

Sign In for Pricing
View Details
Anti-Mouse CD64 Monoclonal Antibody (PE/Cyanine5 Conjugated)
MBS2559343-02 0.1 mg

Anti-Mouse CD64 Monoclonal Antibody (PE/Cyanine5 Conjugated)

Sign In for Pricing
View Details
Anti-Mouse CD64 Monoclonal Antibody (PE/Cyanine5 Conjugated)
MBS2559343-03 5x 0.1 mg

Anti-Mouse CD64 Monoclonal Antibody (PE/Cyanine5 Conjugated)

Sign In for Pricing
View Details