Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASPH Rabbit pAb (APR19750N)

Product Specifications

Background

This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF) -like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ASPH Rabbit pAb (APR19750N) .

Synonyms

ASPH; AAH; BAH; CASQ2BP1; FDLAB; HAAH; JCTN; junctin

Gene ID

444

UniProt

Q12797

Cellular Locus

Endoplasmic reticulum membrane, Sarcoplasmic reticulum membrane, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21-34kDa/83-85kDa Observed MW: 86kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=444

Uniprot URL

https://www.uniprot.org/uniprot/Q12797

AA Sequence

ERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adducin, phosphorylated (Ser 724) (phosphoAdducin) (MaxLight 405) discontinued
A0859-55-ML405 100 µL

Adducin, phosphorylated (Ser 724) (phosphoAdducin) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Pym1 (NM_001108986) Rat Tagged ORF Clone Lentiviral Particle
RR214430L3V 200 µL

Pym1 (NM_001108986) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
POU5F1 (POU Domain, Class 5, Transcription Factor 1, POU Domain Protein 2, pou5f1, gp-9, pou-2, pou2) (Biotin)
MBS6458298-01 0.1 mL

POU5F1 (POU Domain, Class 5, Transcription Factor 1, POU Domain Protein 2, pou5f1, gp-9, pou-2, pou2) (Biotin)

Sign In for Pricing
View Details
POU5F1 (POU Domain, Class 5, Transcription Factor 1, POU Domain Protein 2, pou5f1, gp-9, pou-2, pou2) (Biotin)
MBS6458298-02 5x 0.1 mL

POU5F1 (POU Domain, Class 5, Transcription Factor 1, POU Domain Protein 2, pou5f1, gp-9, pou-2, pou2) (Biotin)

Sign In for Pricing
View Details
GPR64 Antibody
C43984-01 50 µL

GPR64 Antibody

Sign In for Pricing
View Details
GPR64 Antibody
C43984-02 100 µL

GPR64 Antibody

Sign In for Pricing
View Details