Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP Rabbit pAb (APR19731N)

Product Specifications

Background

This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c (+) dendritic cells. The protein promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target for the treatment of such diseases. Alternative splicing of this gene results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TSLP Rabbit pAb (APR19731N) .

Synonyms

TSLP

Gene ID

85480

UniProt

Q969D9

Cellular Locus

Secreted

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 7kDa/18kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=85480

Uniprot URL

https://www.uniprot.org/uniprot/Q969D9

AA Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Stanniocalcin 2/STC-2 Antibody [CoraFluor 1]
NBP3-00170CL1 0.1 mL

Rabbit Polyclonal Stanniocalcin 2/STC-2 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Anti-Human Uncoupling Protein 4 (UCP4) Ab # 1
UCP41-S 100 µL

Anti-Human Uncoupling Protein 4 (UCP4) Ab # 1

Sign In for Pricing
View Details
SIRT1 Recombinant Antibody [9E9] (OACA12575)
OACA12575-100UL 100 µL

SIRT1 Recombinant Antibody [9E9] (OACA12575)

Sign In for Pricing
View Details
LOC688318 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6042308 1.0 µg DNA

LOC688318 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
100 mM b-cyclodextrin
0609 100 mL

100 mM b-cyclodextrin

Sign In for Pricing
View Details
Cdc16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
15596116 3x 1.0 µg

Cdc16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details