Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIRREL2 Rabbit pAb (APR19727N)

Product Specifications

Background

This gene encodes a type I transmembrane protein and member of the immunoglobulin superfamily of cell adhesion molecules. The encoded protein localizes to adherens junctions in pancreatic beta cells and regulates insulin secretion. Autoantibodies against the encoded protein have been detected in serum from patients with type 1 diabetes. This gene may also play a role in glomerular development and decreased expression of this gene has been observed in human glomerular diseases. This gene and the related opposite-strand gene nephrin (GeneID: 527362) are regulated by a bidirectional promoter.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KIRREL2 Rabbit pAb (APR19727N) .

Synonyms

KIRREL2; FILTRIN; NEPH3; NLG1

Gene ID

84063

UniProt

Q6UWL6

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa/61kDa/67kDa/75kDa Observed MW: 95kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84063

Uniprot URL

https://www.uniprot.org/uniprot/Q6UWL6

AA Sequence

GPSPHFLQQPEDLVVLLGEEARLPCALGAYWGLVQWTKSGLALGGQRDLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGPSVSLVAGVPANLTCRSRGDARPTPELLWFRDGVLLDGATFHQTLLKEGTPGSVESTLTLTPFSHDDGATFVCRARSQALPTGRDTAIT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gm11595 shRNA (UAS) - Lentiviral mouseGm11595 shRNA (UAS, GFP) (25)
GTR15265736 1 Vial

Lentiviral mouse Gm11595 shRNA (UAS) - Lentiviral mouseGm11595 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TBC1D30 siRNA Oligos set (Human)
46249171 3x 5 nmol

TBC1D30 siRNA Oligos set (Human)

Sign In for Pricing
View Details
AMBRA1 (NM_017749) Human Over-expression Lysate
LS055626-20ug 20 µg

AMBRA1 (NM_017749) Human Over-expression Lysate

Sign In for Pricing
View Details
Uncoated Human GDNF (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit
MBS2571694-01 24 Tests (Limit 1)

Uncoated Human GDNF (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human GDNF (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit
MBS2571694-02 5x 96 Tests

Uncoated Human GDNF (Glial Cell Line Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
CRP HDR Plasmid (h)
sc-401767-HDR 20 µg

CRP HDR Plasmid (h)

Sign In for Pricing
View Details