Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM26 Rabbit pAb (APR19716N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RBM26 Rabbit pAb (APR19716N) .

Synonyms

RBM26; ARRS2; C13orf10; PPP1R132; PRO1777; SE70-2; ZC3H17

Gene ID

64062

UniProt

Q5T8P6

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/60kDa/62kDa/110kDa/111kDa/113kDa Observed MW: 113kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64062

Uniprot URL

https://www.uniprot.org/uniprot/Q5T8P6

AA Sequence

TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NHLRC1 Rabbit Polyclonal Antibody
E28PN8144 100 µL

NHLRC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (Biotin)
MBS6424254-01 0.1 mL

KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (Biotin)

Sign In for Pricing
View Details
KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (Biotin)
MBS6424254-02 5x 0.1 mL

KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (Biotin)

Sign In for Pricing
View Details
Monoclonal HLA-DRB (MHC II) Antibody - Without BSA and Azide, Clone: HLA-DRB/1067
AMM00855G 0.1mg

Monoclonal HLA-DRB (MHC II) Antibody - Without BSA and Azide, Clone: HLA-DRB/1067

Sign In for Pricing
View Details
Recombinant Mycobacterium Vanbaalenii rpsH Protein (aa 1-132)
VAng-Yyj5131-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Vanbaalenii rpsH Protein (aa 1-132)

Sign In for Pricing
View Details
Rat GLI family zinc finger 2 (GLI2) ELISA Kit
abx259331 96 Tests

Rat GLI family zinc finger 2 (GLI2) ELISA Kit

Sign In for Pricing
View Details