Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM26 Rabbit pAb (APR19716N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RBM26 Rabbit pAb (APR19716N) .

Synonyms

RBM26; ARRS2; C13orf10; PPP1R132; PRO1777; SE70-2; ZC3H17

Gene ID

64062

UniProt

Q5T8P6

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/60kDa/62kDa/110kDa/111kDa/113kDa Observed MW: 113kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64062

Uniprot URL

https://www.uniprot.org/uniprot/Q5T8P6

AA Sequence

TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFTA Human Pre-designed siRNA Set A
HY-RS16052 1 Set

ZFTA Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
KIAA1429 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV702072 1.0 µg DNA

KIAA1429 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Monoclonal UBE2W Antibody (10) [mFluor Violet 500 SE]
NBP3-05884MFV500 0.1 mL

Mouse Monoclonal UBE2W Antibody (10) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Mylk3, NT (Mylk3, Putative myosin light chain kinase 3) (AP)
MBS6323396-01 0.2 mL

Mylk3, NT (Mylk3, Putative myosin light chain kinase 3) (AP)

Sign In for Pricing
View Details
Mylk3, NT (Mylk3, Putative myosin light chain kinase 3) (AP)
MBS6323396-02 5x 0.2 mL

Mylk3, NT (Mylk3, Putative myosin light chain kinase 3) (AP)

Sign In for Pricing
View Details
Brix1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4765706 1.0 µg DNA

Brix1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details