Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWEAKR/Fn14/CD266 Rabbit pAb (APR19690N)

Product Specifications

Background

Fn14 (tumor necrosis factor receptor superfamily, member 12A), also known as TNFRSF12A, is the receptor for TNFSF12/TWEAK. Human and mouse TNFRSF12A share 82% aa sequence identity. TNFRSF12A transcript was expressed at high levels in heart, placenta, and kidney, at intermediate levels in lung, skeletal muscle, and pancreas, and at low levels in brain and liver. In addition, elevated TNFRSF12A expression was found in human liver cancer cell lines and hepatocellular carcinoma specimens. TNFRSF12A is the weak inducer of apoptosis in some cell types. It promotes angiogenesis and the proliferation of endothelial cells. TNFRSF12A may modulate cellular adhesion to matrix proteins.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TWEAKR/Fn14/CD266 Rabbit pAb (APR19690N) .

Synonyms

TNFRSF12A; CD266; FN14; TWEAKR

Gene ID

51330

UniProt

Q9NP84

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa/13kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51330

Uniprot URL

https://www.uniprot.org/uniprot/Q9NP84

AA Sequence

EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZFYVE1 qPCR Primer Pair
QH42097S 200 Tests

Human ZFYVE1 qPCR Primer Pair

Sign In for Pricing
View Details
SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated
MF-0130848-01 5 µg

SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated
MF-0130848-02 10 µg

SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated
MF-0130848-03 20 µg

SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated
MF-0130848-04 50 µg

SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated
MF-0130848-05 100 µg

SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated

Sign In for Pricing
View Details