Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCN1L1 Rabbit pAb (APR19671N)

Product Specifications

Background

Acts as a positive activator of the EIF2AK4/GCN2 protein kinase activity in response to amino acid starvation. Forms a complex with EIF2AK4/GCN2 on translating ribosomes; during this process, GCN1 seems to act as a chaperone to facilitate delivery of uncharged tRNAs that enter the A site of ribosomes to the tRNA-binding domain of EIF2AK4/GCN2, and hence stimulating EIF2AK4/GCN2 kinase activity. Participates in the repression of global protein synthesis and in gene-specific mRNA translation activation, such as the transcriptional activator ATF4, by promoting the EIF2AK4/GCN2-mediated phosphorylation of eukaryotic translation initiation factor 2 (eIF-2-alpha/EIF2S1 on 'Ser-52', and hence allowing ATF4-mediated reprogramming of amino acid biosynthetic gene expression to alleviate nutrient depletion.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GCN1L1 Rabbit pAb (APR19665N5) .

Synonyms

GCN1; GCN1L; GCN1L1; PRIC295

Gene ID

10985

UniProt

Q92616

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 292kDa Observed MW: 265kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10985

Uniprot URL

https://www.uniprot.org/uniprot/Q92616

AA Sequence

LSAVLQQCLLADVSGIDWMVRHGRSLALSVAVNVAPGRLCAGRYSSDVQEMILSSATADRIPIAVSGVRGMGFLMRHHIETGGGQLPAKLSSLFVKCLQNPSSDIRLVAEKMIWWANKDPLPPLDPQAIKPILKALLDNTKDKNTVVRAYSDQAIVNLLKMRQGEEVFQSLSKILDVASLEVLNEVNRRSLKKLASQADSTEQVDDTILT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

D4S234E, NT (NSG1, D4S234, Neuron-specific protein family member 1, Brain neuron cytoplasmic protein 1) (AP)
MBS6290650-01 0.2 mL

D4S234E, NT (NSG1, D4S234, Neuron-specific protein family member 1, Brain neuron cytoplasmic protein 1) (AP)

Sign In for Pricing
View Details
D4S234E, NT (NSG1, D4S234, Neuron-specific protein family member 1, Brain neuron cytoplasmic protein 1) (AP)
MBS6290650-02 5x 0.2 mL

D4S234E, NT (NSG1, D4S234, Neuron-specific protein family member 1, Brain neuron cytoplasmic protein 1) (AP)

Sign In for Pricing
View Details
BBS9 (NM_001033604) Human Tagged ORF Clone Lentiviral Particle
RC213100L3V 200 µL

BBS9 (NM_001033604) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal VBP1 Antibody (OTI2E6) [Alexa Fluor 405]
NBP2-74836AF405 0.1 mL

Mouse Monoclonal VBP1 Antibody (OTI2E6) [Alexa Fluor 405]

Sign In for Pricing
View Details
IL-33, His, Cynomolgus
Z04842-500 500 µg

IL-33, His, Cynomolgus

Sign In for Pricing
View Details
pU6-MCS-sgRNA-CBH-Cas9-EGFP-SV40-Puro Plasmid
PVT45429 2 µg

pU6-MCS-sgRNA-CBH-Cas9-EGFP-SV40-Puro Plasmid

Sign In for Pricing
View Details