Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBCA Rabbit pAb (APR19645N)

Product Specifications

Background

The product of this gene is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. This gene encodes chaperonin cofactor A. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TBCA Rabbit pAb (APR19645N) .

Synonyms

TBCA

Gene ID

6902

UniProt

O75347

Cellular Locus

Cytoplasm, cytoskeleton

Dilution

WB 1:1000 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/15kDa Observed MW: 13kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6902

Uniprot URL

https://www.uniprot.org/uniprot/O75347

AA Sequence

MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-NAT2
YF-PA10008 100 ul

anti-NAT2

Sign In for Pricing
View Details
SHC2 Recombinant Protein
OPCD06957-50UG 50 µg

SHC2 Recombinant Protein

Sign In for Pricing
View Details
Psg21 CRISPR Activation Plasmid (m)
sc-428285-ACT 20 µg

Psg21 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Mouse Peptidyl-prolyl cis-trans isomerase-like 6, PPIL6 ELISA Kit
MBS9339651-01 48 Well

Mouse Peptidyl-prolyl cis-trans isomerase-like 6, PPIL6 ELISA Kit

Sign In for Pricing
View Details
Mouse Peptidyl-prolyl cis-trans isomerase-like 6, PPIL6 ELISA Kit
MBS9339651-02 96 Well

Mouse Peptidyl-prolyl cis-trans isomerase-like 6, PPIL6 ELISA Kit

Sign In for Pricing
View Details
Mouse Peptidyl-prolyl cis-trans isomerase-like 6, PPIL6 ELISA Kit
MBS9339651-03 5x 96 Well

Mouse Peptidyl-prolyl cis-trans isomerase-like 6, PPIL6 ELISA Kit

Sign In for Pricing
View Details