Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYS2 Rabbit pAb (APR19614N)

Product Specifications

Background

The protein encoded by this gene, liver glycogen synthase, catalyzes the rate-limiting step in the synthesis of glycogen - the transfer of a glucose molecule from UDP-glucose to a terminal branch of the glycogen molecule. Mutations in this gene cause glycogen storage disease type 0 (GSD-0) - a rare type of early childhood fasting hypoglycemia with decreased liver glycogen content.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GYS2 Rabbit pAb (APR19614N) .

Synonyms

GYS2

Gene ID

2998

UniProt

P54840

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 80kDa Observed MW: 81kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2998

Uniprot URL

https://www.uniprot.org/uniprot/P54840

AA Sequence

DLLDWRYLGRYYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin Linked Kinase (ILK) Rabbit Polyclonal Antibody
TA364492 100 µL

Integrin Linked Kinase (ILK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QKI-5 Recombinant Mouse monoclonal Antibody
HA610223 100 µg

QKI-5 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Tnfsf9 Rabbit Monoclonal Antibody [Clone ID: AT113-2]
TA386222 200 µg

Tnfsf9 Rabbit Monoclonal Antibody [Clone ID: AT113-2]

Sign In for Pricing
View Details
SLC25A23 Rabbit Polyclonal Antibody
TA361669 100 µL

SLC25A23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CIITA Human Gene Knockout Kit (CRISPR)
KN222253LP 1 Kit

CIITA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse F10 activation kit by CRISPRa
GA201332 1 Kit

Mouse F10 activation kit by CRISPRa

Sign In for Pricing
View Details