Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARR3 Rabbit pAb (APR19603N)

Product Specifications

Background

The protein encoded by this gene is a non-visual arrestin which binds to agonist-activated, phosphorylated G protein-coupled receptors. This binding uncouples the receptor from the heterotrimeric G protein, resulting in termination of the G protein-coupled receptor signaling. The encoded protein also is a part of the centrosome, interacting with gamma-tubulin to help regulate proper centrosome function.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ARR3 Rabbit pAb (APR19595N9) .

Synonyms

ARR3; ARRX; cArr

Gene ID

407

UniProt

P36575

Applications

WB (Cynoglossus semilaevis)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/42kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=407

Uniprot URL

https://www.uniprot.org/uniprot/P36575

AA Sequence

MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I assembly protein Ycf4 (ycf4), partial
MBS7088517 Inquire

Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I assembly protein Ycf4 (ycf4), partial

Sign In for Pricing
View Details
Bovine Survivin (Surv) ELISA Kit
MBS2609819-01 48 Well

Bovine Survivin (Surv) ELISA Kit

Sign In for Pricing
View Details
Bovine Survivin (Surv) ELISA Kit
MBS2609819-02 96 Well

Bovine Survivin (Surv) ELISA Kit

Sign In for Pricing
View Details
Bovine Survivin (Surv) ELISA Kit
MBS2609819-03 5x 96 Well

Bovine Survivin (Surv) ELISA Kit

Sign In for Pricing
View Details
Bovine Survivin (Surv) ELISA Kit
MBS2609819-04 10x 96 Well

Bovine Survivin (Surv) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Map1s shRNA (UAS) - Lentiviral mouse Map1s shRNA (UAS, RFP) (25)
GTR15212183 1 Vial

Lentiviral mouse Map1s shRNA (UAS) - Lentiviral mouse Map1s shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details