Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARR3 Rabbit pAb (APR19603N)

Product Specifications

Background

The protein encoded by this gene is a non-visual arrestin which binds to agonist-activated, phosphorylated G protein-coupled receptors. This binding uncouples the receptor from the heterotrimeric G protein, resulting in termination of the G protein-coupled receptor signaling. The encoded protein also is a part of the centrosome, interacting with gamma-tubulin to help regulate proper centrosome function.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ARR3 Rabbit pAb (APR19595N9) .

Synonyms

ARR3; ARRX; cArr

Gene ID

407

UniProt

P36575

Applications

WB (Cynoglossus semilaevis)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/42kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=407

Uniprot URL

https://www.uniprot.org/uniprot/P36575

AA Sequence

MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Shigella flexneri MTR Polyclonal Antibody
MBS7165557 Inquire

Rabbit anti-Shigella flexneri MTR Polyclonal Antibody

Sign In for Pricing
View Details
ELISA kit for Canine Transforming growth factor Beta1 (TGF-Beta1)
KTE20026-01 48 Tests

ELISA kit for Canine Transforming growth factor Beta1 (TGF-Beta1)

Sign In for Pricing
View Details
ELISA kit for Canine Transforming growth factor Beta1 (TGF-Beta1)
KTE20026-02 96 Tests

ELISA kit for Canine Transforming growth factor Beta1 (TGF-Beta1)

Sign In for Pricing
View Details
ELISA kit for Canine Transforming growth factor Beta1 (TGF-Beta1)
KTE20026-03 5x 96 Well

ELISA kit for Canine Transforming growth factor Beta1 (TGF-Beta1)

Sign In for Pricing
View Details
BRG1 (SMARCA4) Rabbit Monoclonal Antibody
TA422713 100 µL

BRG1 (SMARCA4) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
2- (Thiophen-2-yl) pyridine-4-carbonitrile
OR73524-01 100 mg

2- (Thiophen-2-yl) pyridine-4-carbonitrile

Sign In for Pricing
View Details