Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40L Rabbit pAb (APR19598N)

Product Specifications

Background

The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD40L Rabbit pAb (APR19598N) .

Synonyms

CD154; CD40L; HIGM1; IGM; IMD3; T-BAM; TNFSF5; TRAP; gp39; hCD40L; CD40LG

Gene ID

959

UniProt

P29965

Cellular Locus

Cell membrane, Secreted, Single-pass type II membrane protein

Dilution

WB 1:1000 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa Observed MW: 25-30KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=959

Uniprot URL

https://www.uniprot.org/uniprot/P29965

AA Sequence

LSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNPQIAAHVISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey LPS ELISA Kit
EMKL0275 96 Tests

Monkey LPS ELISA Kit

Sign In for Pricing
View Details
Mmu-miR-210-3p miRNA Agomir
orb1918802-01 5 nmol

Mmu-miR-210-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-210-3p miRNA Agomir
orb1918802-02 10 nmol

Mmu-miR-210-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-210-3p miRNA Agomir
orb1918802-03 20 nmol

Mmu-miR-210-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse Monoclonal CD28 Antibody (C28/1636) [Alexa Fluor 350]
NBP2-54573AF350 0.1 mL

Mouse Monoclonal CD28 Antibody (C28/1636) [Alexa Fluor 350]

Sign In for Pricing
View Details
Recombinant Mouse Meningioma Expressed Antigen 5 (MGEA5)
RPU42919-01 50 µg

Recombinant Mouse Meningioma Expressed Antigen 5 (MGEA5)

Sign In for Pricing
View Details