Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P63 Rabbit pAb (APR19583N)

Product Specifications

Background

This gene encodes a member of the p53 family of transcription factors. The functional domains of p53 family proteins include an N-terminal transactivation domain, a central DNA-binding domain and an oligomerization domain. Alternative splicing of this gene and the use of alternative promoters results in multiple transcript variants encoding different isoforms that vary in their functional properties. These isoforms function during skin development and maintenance, adult stem/progenitor cell regulation, heart development and premature aging. Some isoforms have been found to protect the germline by eliminating oocytes or testicular germ cells that have suffered DNA damage. Mutations in this gene are associated with ectodermal dysplasia, and cleft lip/palate syndrome 3 (EEC3) ; split-hand/foot malformation 4 (SHFM4) ; ankyloblepharon-ectodermal defects-cleft lip/palate; ADULT syndrome (acro-dermato-ungual-lacrimal-tooth) ; limb-mammary syndrome; Rap-Hodgkin syndrome (RHS) ; and orofacial cleft 8.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality p63 Rabbit pAb (APR19583N) .

Synonyms

AIS; B (p51A) ; B (p51B) ; EEC3; KET; LMS; NBP; OFC8; RHS; SHFM4; TP53CP; TP53L; TP73L; p40; p51; p53CP; p63; p73H; p73L; TP63

Gene ID

8626

UniProt

Q9H3D4

Cellular Locus

Nucleus

Applications

WB (Mus musculus)

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 44-76kDa Observed MW: 77kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8626

Uniprot URL

https://www.uniprot.org/uniprot/Q9H3D4

AA Sequence

MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD209 Rabbit monoclonal antibody
E43S40593 100 µL

CD209 Rabbit monoclonal antibody

Sign In for Pricing
View Details
MEX3A Rabbit Polyclonal Antibody
JOT-AP03598-01 50ul

MEX3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MEX3A Rabbit Polyclonal Antibody
JOT-AP03598-02 100ul

MEX3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mb21d2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6677508 1.0 µg DNA

Mb21d2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
T-Cell Activation Antigen, Increased Late Expression (TACTILE) BioAssayTM ELISA Kit (Human)
517683 96 Tests

T-Cell Activation Antigen, Increased Late Expression (TACTILE) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
mmu-miR-377 miRNA Inhibitor
MIM01996 2x 5.0 nmol

mmu-miR-377 miRNA Inhibitor

Sign In for Pricing
View Details