Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMA3A Rabbit pAb (APR19582N)

Product Specifications

Background

This gene is a member of the semaphorin family and encodes a protein with an Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a Sema domain. This secreted protein can function as either a chemorepulsive agent, inhibiting axonal outgrowth, or as a chemoattractive agent, stimulating the growth of apical dendrites. In both cases, the protein is vital for normal neuronal pattern development. Increased expression of this protein is associated with schizophrenia and is seen in a variety of human tumor cell lines. Also, aberrant release of this protein is associated with the progression of Alzheimer's disease.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SEMA3A Rabbit pAb (APR19582N) .

Synonyms

SEMA3A; COLL1; HH16; Hsema-I; Hsema-III; SEMA1; SEMAD; SEMAIII; SEMAL; SemD; coll-1

Gene ID

10371

UniProt

Q14563

Cellular Locus

Secreted

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 88kDa Observed MW: 89kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10371

Uniprot URL

https://www.uniprot.org/uniprot/Q14563

AA Sequence

GIDTHFDELQDVFLMNFKDPKNPVVYGVFTTSSNIFKGSAVCMYSMSDVRRVFLGPYAHRDGPNYQWVPYQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PCDHA2  (2G12)
YF-MA18939 100 ug

Anti-PCDHA2 (2G12)

Sign In for Pricing
View Details
Rad52 Rabbit Polyclonal Antibody (BF555)
orb2476407 100 µL

Rad52 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Ric8a sgRNA CRISPR Lentivector (Rat) (Target 1)
K7344202 1.0 µg DNA

Ric8a sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
NDUFA3 (NM_004542) Human Untagged Clone
SC117329 10 µg

NDUFA3 (NM_004542) Human Untagged Clone

Sign In for Pricing
View Details
BCL2L2-PABPN1 Protein Vector (Human) (pPM-C-HA)
13239021 500 ng

BCL2L2-PABPN1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Tridecanoic-d25 Acid
TRC-T774687-10MG 10 mg

Tridecanoic-d25 Acid

Sign In for Pricing
View Details