Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMA3A Rabbit pAb (APR19582N)

Product Specifications

Background

This gene is a member of the semaphorin family and encodes a protein with an Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a Sema domain. This secreted protein can function as either a chemorepulsive agent, inhibiting axonal outgrowth, or as a chemoattractive agent, stimulating the growth of apical dendrites. In both cases, the protein is vital for normal neuronal pattern development. Increased expression of this protein is associated with schizophrenia and is seen in a variety of human tumor cell lines. Also, aberrant release of this protein is associated with the progression of Alzheimer's disease.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SEMA3A Rabbit pAb (APR19582N) .

Synonyms

SEMA3A; COLL1; HH16; Hsema-I; Hsema-III; SEMA1; SEMAD; SEMAIII; SEMAL; SemD; coll-1

Gene ID

10371

UniProt

Q14563

Cellular Locus

Secreted

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 88kDa Observed MW: 89kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10371

Uniprot URL

https://www.uniprot.org/uniprot/Q14563

AA Sequence

GIDTHFDELQDVFLMNFKDPKNPVVYGVFTTSSNIFKGSAVCMYSMSDVRRVFLGPYAHRDGPNYQWVPYQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Herc4 CRISPR Activation Plasmid (h)
sc-410498-ACT 20 µg

Herc4 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
SES1 Recombinant Protein
OPCA03237-100UG 100 µg

SES1 Recombinant Protein

Sign In for Pricing
View Details
ZBTB38 (N-term) Rabbit Polyclonal Antibody
AP54612PU-N 400 µL

ZBTB38 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D2HGDH Protein Vector (Mouse) (pPM-C-His)
PV170129 500 ng

D2HGDH Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Reinecke Salt
R8160 25 g

Reinecke Salt

Sign In for Pricing
View Details
Magic™ Membrane Protein Human IL10RB (Interleukin 10 receptor subunit beta) for Antibody Discovery
MP0545X Each

Magic™ Membrane Protein Human IL10RB (Interleukin 10 receptor subunit beta) for Antibody Discovery

Sign In for Pricing
View Details