Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX3 Rabbit pAb (APR19580N)

Product Specifications

Background

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and may transduce ATP-evoked nociceptor activation. Mouse studies suggest that this receptor is important for peripheral pain responses, and also participates in pathways controlling urinary bladder volume reflexes. It is possible that the development of selective antagonists for this receptor may have a therapeutic potential in pain relief and in the treatment of disorders of urine storage.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality P2RX3 Rabbit pAb (APR19580N) .

Synonyms

P2RX3; P2X3

Gene ID

5024

UniProt

P56373

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 44kDa Observed MW: 44kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5024

Uniprot URL

https://www.uniprot.org/uniprot/P56373

AA Sequence

AFTSVGVGTVLCDIILLNFLKGADQYKAKKFEEVNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Acetyl-5- (heptafluoropropyl) -4-nitro-3-phenyl-1H-pyrazole
PC1962 1 Each

1-Acetyl-5- (heptafluoropropyl) -4-nitro-3-phenyl-1H-pyrazole

Sign In for Pricing
View Details
PHIP Protein Vector (Mouse) (pPB-C-His)
PV215758 500 ng

PHIP Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Anti-IRF-4 antibody
STJ93764 200 µl

Anti-IRF-4 antibody

Sign In for Pricing
View Details
Zxdc 3'UTR GFP Stable Cell Line
TU273955 1.0 mL

Zxdc 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TRNAA10 sgRNA CRISPR Lentivector set (Human)
K2473101 3x 1.0 µg

TRNAA10 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Anti-NF-κB p65 Rabbit pAb
GB11997-100 100 μL

Anti-NF-κB p65 Rabbit pAb

Sign In for Pricing
View Details