Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECH1 Rabbit pAb (APR19561N)

Product Specifications

Background

This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ECH1 Rabbit pAb (APR19561N) .

Synonyms

ECH1; HPXEL

Gene ID

1891

UniProt

Q13011

Cellular Locus

Mitochondrion, Peroxisome

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1891

Uniprot URL

https://www.uniprot.org/uniprot/Q13011

AA Sequence

MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR1296 ORF Vector (Human) (pORF)
ORF023690 1.0 µg DNA

MIR1296 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
KALRN CRISPRa sgRNA lentivector (set of three targets)(Rat)
25279126 3x 1.0µg DNA

KALRN CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Recombinant Rat IL-4 Protein
MBS9148911-01 0.01 mg

Recombinant Rat IL-4 Protein

Sign In for Pricing
View Details
Recombinant Rat IL-4 Protein
MBS9148911-02 0.02 mg

Recombinant Rat IL-4 Protein

Sign In for Pricing
View Details
Recombinant Rat IL-4 Protein
MBS9148911-03 0.05 mg

Recombinant Rat IL-4 Protein

Sign In for Pricing
View Details
Recombinant Rat IL-4 Protein
MBS9148911-04 0.1 mg

Recombinant Rat IL-4 Protein

Sign In for Pricing
View Details