Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VAPA Rabbit pAb (APR19555N)

Product Specifications

Background

The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VAPA Rabbit pAb (APR19555N) .

Synonyms

VAPA; VAP-33; VAP-A; VAP33; hVAP-33

Gene ID

9218

UniProt

Q9P0L0

Cellular Locus

Endoplasmic reticulum membrane, Single-pass type IV membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 27kDa/32kDa Observed MW: 28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9218

Uniprot URL

https://www.uniprot.org/uniprot/Q9P0L0

AA Sequence

DKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slide Cabinet BCBT-301
BCBT-301 1 Unit

Slide Cabinet BCBT-301

Sign In for Pricing
View Details
Microplate Reader BMRW-101
BMRW-101 1 Unit

Microplate Reader BMRW-101

Sign In for Pricing
View Details
S100B (S100B/1012), CF647 conjugate, 0.1mg/mL
BNC471012-100 1x 100 µL

S100B (S100B/1012), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM3B (NM_206964) Human Over-expression Lysate
LY403719 100 µg

FAM3B (NM_206964) Human Over-expression Lysate

Sign In for Pricing
View Details
Septin-2 Antibody
KC-42786-01 50 μL

Septin-2 Antibody

Sign In for Pricing
View Details
Septin-2 Antibody
KC-42786-02 100 µL

Septin-2 Antibody

Sign In for Pricing
View Details